PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 114aa    MW: 13496.7 Da    PI: 10.296
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59036.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.52.1e-29959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krienk+nrqvtfskRr g+lKKA+E+SvLCda+v +iifs +gk++ey++
  EPS59036.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVGLIIFSAKGKIFEYAT 59
                79***********************************************86 PP

2K-box15.85.7e-07871121136
       K-box  11 eakaeslqqelakLkkeienLqreqR 36 
                  ++  s+q e+akLk++++ Lqr+qR
  EPS59036.1  87 LETPRSWQLEHAKLKARMDVLQRNQR 112
                 556789******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.693161IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-33283IPR002100Transcription factor, MADS-box
CDDcd002651.37E-40275No hitNo description
PRINTSPR004044.9E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD ADVGLIIFSA KGKIFEYATD  60
SCMERILERY ERCSYTERHM TEQPPELETP RSWQLEHAKL KARMDVLQRN QRFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-21179176Myocyte-specific enhancer factor 2B
1tqe_Q1e-21179176Myocyte-specific enhancer factor 2B
1tqe_R1e-21179176Myocyte-specific enhancer factor 2B
1tqe_S1e-21179176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086918.14e-64PREDICTED: truncated transcription factor CAULIFLOWER A
RefseqXP_011086917.14e-64PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ424295e-61AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLS8C3S02e-81S8C3S0_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000633132e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-55AGAMOUS-like 8
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]